- PDSS2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88740
- C6orf210, COQ10D3, COQ1B, DLP1, bA59I9.3, hDLP1
- 0.1 ml (also 25ul)
- PDSS2
- This antibody was developed against Recombinant Protein corresponding to amino acids: FIKEKTSDSM TFNLNSAPVV LHQEFLGRDL WIKQIGEAQE KGRLDYAKLR ERIKAGKGVT SAIDLCRY
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Unconjugated
- Human, Mouse, Rat
- decaprenyl diphosphate synthase subunit 2
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
FIKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIGEAQEKGRLDYAKLRERIKAGKGVTSAIDLCRY
Specifications/Features
Available conjugates: Unconjugated